General Information

  • ID:  hor005620
  • Uniprot ID:  P45656
  • Protein name:  Gonadotropin-releasing hormone-associated peptide
  • Gene name:  gnrh1
  • Organism:  Xenopus laevis (African clawed frog)
  • Family:  GnRH family
  • Source:  animal
  • Expression:  First expressed in late larvae (stages 62-64). Also expressed in adults. |Expressed in the forebrain from larval stages.
  • Disease:  NA
  • Comments:  NA
  • Taxonomy:  Xenopus (subgenus), Xenopus (genus), Xenopodinae (subfamily), Pipidae (family), Pipoidea (superfamily), Anura (order), Batrachia (superorder), Amphibia (class), Tetrapoda, Dipnotetrapodomorpha, Sarcopterygii (superclass), Euteleostomi, Teleostomi, Gnathostomata, Vertebrata, Craniata (subphylum), Chordata (phylum), Deuterostomia, Bilateria, Eumetazoa, Metazoa (kingdom), Opisthokonta, Eukaryota (superkingdom), cellular organisms
  • GO MF:  GO:0005179 hormone activity; GO:0005183 gonadotropin hormone-releasing hormone activity
  • GO BP:  GO:0007165 signal transduction
  • GO CC:  GO:0005576 extracellular region; GO:0005615 extracellular space

Sequence Information

  • Sequence:  DTESLQDMYHETPNEVALFPELERLECSVPQSRLNVLRGALMNWLEGENRKKI
  • Length:  53
  • Propeptide:  MKAFPTFALLFLVLLFSAHVSDAQHWSYGLRPGGKRDTESLQDMYHETPNEVALFPELERLECSVPQSRLNVLRGALMNWLEGENRKKI
  • Signal peptide:  MKAFPTFALLFLVLLFSAHVSDA
  • Modification:  NA
  • Glycosylation:  NA
  • Mutagenesis:  NA

Activity

  • Function:  Stimulates the secretion of gonadotropins.
  • Mechanism:  NA
  • Cross BBB:  NA
  • Target:  NA
  • Target Unid:  NA
  • IC50: NA
  • EC50: NA
  • ED50: NA
  • kd: NA
  • Half life: NA

Structure

  • Disulfide bond:  NA
  • Structure ID:  AF-P51922-F1(AlphaFold_DB_ID)

  • Structure: (PDB_ID-from https://www.rcsb.org/; AlphaFold_DB_ID-from https://alphafold.ebi.ac.uk/; hordbxxxxxx_AF2.pdb was predicted structure by AlphaFold2; hordbxxxxxx_ESM.pdb was predicted structure by ESMFold)
    •    hor005620_AF2.pdbhor005620_ESM.pdb

Physical Information

Mass: 712870 Formula: C269H430N76O86S3
Absent amino acids: Common amino acids: EL
pI: 4.45 Basic residues: 7
Polar residues: 13 Hydrophobic residues: 16
Hydrophobicity: -68.68 Boman Index: -12729
Half-Life: 1.1 hour Half-Life Yeast: 3 min
Half-Life E.Coli: >10 hour Aliphatic Index 86.42
Instability Index: 6299.81 Extinction Coefficient cystines: 6990
Absorbance 280nm: 134.42

Literature

  • PubMed ID:  8137750
  • Title:  The frog gonadotropin-releasing hormone-I (GnRH-I) gene has a mammalian-like expression pattern and conserved domains in GnRH-associated peptide, but brain onset is delayed until metamorphosis.